Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Spinach & Cheese Fatayer

Crispy, flaky Lebanese hand pies stuffed with herbed spinach and cheese, baked until golden. Ready in 20 minutes with store-bought pastry.

Total time
20 min
Servings
4
Calories
280
Protein
8g
Sheet-Pan Spinach & Cheese Fatayer
casualrusticlebanesevegetariancheesecrispyflakyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix spinach, feta, onion, lemon juice, salt, and pepper in a bowl until evenly combined.

  2. Step 2

    Preheat oven to 400°F. Line a sheet pan with parchment paper and lightly brush with olive oil.

  3. Step 3

    Lay one phyllo sheet on the pan. Brush lightly with oil, then top with a second sheet and brush again.

  4. Step 4

    Spoon filling along one long edge, then roll tightly and curve into a triangle. Repeat with remaining sheets.

  5. Step 5

    Brush all fatayer with oil. Bake for 12–15 minutes until golden brown and crispy.

  6. Step 6

    Cool for 2 minutes, then serve warm with flatbread or a side salad.

Tools you’ll need

  • mixing bowl
  • sheet pan
  • parchment paper
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.