Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Chicken with Dill & Fish Sauce

Vietnamese-style pan-fried chicken thighs with a tangy, garlicky dill sauce and crispy skin. Ready in 25 minutes with a vibrant herbaceous punch.

Total time
25 min
Servings
2
Calories
485
Protein
38g
Crispy Chicken with Dill & Fish Sauce
casualquickvietnamesechickencrispytenderjuicyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken thighs dry with paper towels. Season both sides generously with salt and black pepper.

  2. Step 2

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Place chicken skin-side down in the skillet. Cook without moving for 8 minutes until skin is golden and crispy.

  4. Step 4

    Flip chicken and cook 6 minutes more until an instant-read thermometer reaches 165°F at the thickest part.

  5. Step 5

    Push chicken to the side. Add garlic to the empty space and cook 30 seconds until fragrant, then swirl in.

  6. Step 6

    Drizzle fish sauce and lime juice over chicken. Top with dill, scallions, and chile. Serve hot from the pan.

Tools you’ll need

  • 12-inch skillet with a lid (optional)
  • instant-read thermometer
  • paper towels
  • knife for mincing and slicing

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.