CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Chicken with Dill & Fish Sauce

Vietnamese-style pan-fried chicken thighs with a tangy, garlicky dill sauce and crispy skin. Ready in 25 minutes with a vibrant herbaceous punch.

Total time
25 min
Servings
2
Calories
485
Protein
38g
Crispy Chicken with Dill & Fish Sauce
casualquickvietnamesechickencrispytenderjuicyweeknight

Ingredients

  • 4 thighs bone-in, skin-on chicken thighs
  • 3 tbsp fish sauce
  • 1 lime lime (juiced)
  • 3 cloves garlic, minced
  • ½ cup fresh dill, chopped
  • 2 scallions scallions, sliced thin
  • 1 tsp (or 1 fresh chile) chile flake or bird's eye chile, sliced

Instructions

  1. 1

    Pat chicken thighs dry with paper towels. Season both sides generously with salt and black pepper.

  2. 2

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Place chicken skin-side down in the skillet. Cook without moving for 8 minutes until skin is golden and crispy.

  4. 4

    Flip chicken and cook 6 minutes more until an instant-read thermometer reaches 165°F at the thickest part.

  5. 5

    Push chicken to the side. Add garlic to the empty space and cook 30 seconds until fragrant, then swirl in.

  6. 6

    Drizzle fish sauce and lime juice over chicken. Top with dill, scallions, and chile. Serve hot from the pan.

Tools you’ll need

  • 12-inch skillet with a lid (optional)
  • instant-read thermometer
  • paper towels
  • knife for mincing and slicing

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.