Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Erbazzone with Fried Egg

Buttery, crispy-edged spinach and herb pie from Reggio Emilia, topped with a runny fried egg. Ready in 25 minutes using phyllo as a shortcut—no yeast dough needed.

Total time
25 min
Servings
2
Calories
520
Protein
22g
Crispy Erbazzone with Fried Egg
comfortcozyitalianvegetariancheesecrispytenderflaky

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix spinach, ricotta, pecorino, parsley, nutmeg, and a pinch each of salt and pepper in a bowl until combined.

  2. Step 2

    Brush a 10-inch skillet with melted butter. Layer 3 phyllo sheets, brushing butter between each, letting edges overhang.

  3. Step 3

    Spread spinach mixture onto phyllo. Fold overhanging edges over filling. Layer remaining 3 phyllo sheets on top, brushing butter between each.

  4. Step 4

    Cook over medium heat for 8 minutes until the bottom is golden and crispy. Transfer skillet to a 400°F oven.

  5. Step 5

    Bake for 10 minutes until the top is golden and edges curl slightly.

  6. Step 6

    Push erbazzone to the side. Add a pinch of butter to the skillet and crack both eggs into the open space. Cook until whites set, yolks still jiggle, ~3 minutes.

  7. Step 7

    Serve directly from the skillet, cutting the erbazzone in half and sliding an egg onto each portion.

Tools you’ll need

  • 10-inch cast iron or nonstick skillet
  • medium mixing bowl
  • box grater or microplane
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.