Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Italian Cheese & Greens Torta Salata

Flaky, buttery pastry wrapped around creamy ricotta, spinach, and melted cheese. A rustic Italian savory pie that's elegant enough for dinner yet simple enough for weeknights.

Total time
45 min
Servings
4
Calories
385
Protein
16g
Italian Cheese & Greens Torta Salata
comfortelegantitalianvegetariancheeseflakycreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line a 9-inch tart pan or baking sheet with parchment paper.

  2. Step 2

    Wilt spinach in a large skillet over medium heat, stirring occasionally, until completely dry, ~5 minutes.

  3. Step 3

    Let spinach cool slightly, then roughly chop and transfer to a bowl.

  4. Step 4

    Stir ricotta, mozzarella, parmesan, salt, pepper, and nutmeg into the spinach until well combined.

  5. Step 5

    Lay puff pastry sheet on prepared pan. Spread spinach-cheese filling evenly, leaving 1-inch border.

  6. Step 6

    Fold pastry edges over filling, pleating as you go. Some filling will show in the center.

  7. Step 7

    Bake until pastry edges are golden brown and center fills have set, 20-25 minutes.

  8. Step 8

    Cool 5 minutes. Slice into wedges and serve warm or at room temperature.

Tools you’ll need

  • 9-inch tart pan or baking sheet
  • parchment paper
  • large skillet
  • large mixing bowl
  • spatula or wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.