Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Herb & Cheese Skillet Pie

Erbazzone reimagined as a fast stovetop skillet pie: tender greens, ricotta, and Parmigiano-Reggiano in buttery pastry. Ready in under 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
18g
Herb & Cheese Skillet Pie
comfortrusticitalianvegetariancheeseflakytendercreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Melt 2 tbsp butter in a 10-inch nonstick skillet over medium heat, then add greens.

  2. Step 2

    Cook greens, stirring occasionally, until wilted and any liquid evaporates, ~4 minutes.

  3. Step 3

    Stir in ricotta, Parm, herbs, nutmeg, salt, and pepper until combined. Remove from heat.

  4. Step 4

    Lay puff pastry sheet directly over the greens mixture, tucking edges down into the pan.

  5. Step 5

    Dot pastry top with remaining 1 tbsp butter, then return pan to medium heat.

  6. Step 6

    Cook until pastry edges are golden and crispy and you hear a gentle sizzle, ~8 minutes.

Tools you’ll need

  • 10-inch nonstick skillet
  • wooden spoon or spatula
  • grater (for Parm and nutmeg)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.