Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Fried Chicken with Herbs and Chilies

Golden, crunchy chicken pieces tossed with fresh chilies, kaffir lime leaves, and a hint of garlic. A quick, aromatic weeknight dinner that's ready in about 20 minutes.

Total time
20 min
Servings
4
Calories
520
Protein
35g
Crispy Fried Chicken with Herbs and Chilies
comfortingIndonesiangluten-freechickencrispyweeknightmaindinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 1.5 lb chicken pieces dry with paper towels. Season generously with salt and pepper on all sides.

  2. Step 2

    Heat 1 cup vegetable oil in a large skillet over medium-high heat until shimmering, about 2 minutes. Carefully place the chicken in the oil, skin-side down, in a single layer. Fry until golden brown and cooked through, about 8 minutes per side. The chicken should reach 165°F and the skin should be crispy.

  3. Step 3

    Remove the chicken from the skillet and set aside. Pour off all but 2 tbsp of the oil, leaving the browned bits in the pan.

  4. Step 4

    Add the 4 garlic cloves (thinly sliced), 3 red chilies (sliced), 3 green chilies (sliced), and 6 kaffir lime leaves (torn) to the skillet. Cook over medium heat, stirring, until fragrant and the garlic is golden, about 2 minutes.

  5. Step 5

    Return the chicken to the skillet and toss with the herb mixture until well coated. Serve hot, with extra lime wedges if desired.

Tools you’ll need

  • Large skillet
  • Tongs
  • Paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.