Custrd is out on the App Store — Download it free →
Back to recipes

Indonesian Smashed Fried Chicken

Crispy, golden fried chicken with a spicy kick, served with a simple chili sauce. This Indonesian-inspired dish is perfect for a weeknight dinner.

Total time
35 min
Servings
4
Calories
650
Protein
35g
Indonesian Smashed Fried Chicken
comfortingIndonesiandairy-freechickencrispyweeknightmaindinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 1.5 lb chicken thighs dry with paper towels. Using a meat mallet or heavy pan, smash each thigh to an even 1/2-inch thickness.

  2. Step 2

    In a shallow dish, whisk together the 1 cup flour, 1/2 cup cornstarch, 1 tsp garlic powder, 1 tsp salt, and 1/2 tsp black pepper.

  3. Step 3

    Dredge each chicken piece in the flour mixture, pressing firmly to coat. Shake off excess and set aside on a plate.

  4. Step 4

    Heat the 2 cups vegetable oil in a large skillet over medium-high until shimmering, about 5 minutes. To test, drop a pinch of flour—it should sizzle immediately.

  5. Step 5

    Working in batches, fry the chicken for 5-7 minutes per side, until deep golden brown and cooked through (internal temperature reaches 165°F). Do not crowd the pan.

  6. Step 6

    Drain the fried chicken on a wire rack or paper towels. Serve hot with the 1/4 cup sambal oelek on the side for dipping.

  7. Step 7

    Optional: sprinkle with a little extra salt or squeeze of lime before serving if you like.

Tools you’ll need

  • Meat mallet or heavy pan
  • Large skillet
  • Shallow dish
  • Tongs
  • Wire rack or paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.