Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Garlic Parmesan Cauliflower

Roasted cauliflower florets tossed with garlic powder and melted Parmesan cheese until golden and crispy. Serve alongside fresh arugula for a light, satisfying side or vegetarian main.

Total time
20 min
Servings
2
Calories
185
Protein
12g
Crispy Garlic Parmesan Cauliflower
simplequickamericanvegetariancrispytenderweeknightside

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toss cauliflower florets with olive oil, salt, and pepper on a sheet pan.

  2. Step 2

    Spread in a single layer and roast at 425°F for 12 minutes, stirring once.

  3. Step 3

    Mix Parmesan and garlic powder in a small bowl, then sprinkle over hot cauliflower.

  4. Step 4

    Toss gently until cheese coats the florets and crisps, about 1 minute.

  5. Step 5

    Serve cauliflower warm alongside fresh arugula.

Tools you’ll need

  • sheet pan
  • small bowl
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.