Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlic Butter Hilopites with Spinach

Crispy pan-toasted Greek pasta with wilted spinach, finished with garlic butter and crumbly feta. Ready in 15 minutes — the kind of weeknight dinner that tastes way better than it should.

Total time
15 min
Servings
2
Calories
410
Protein
12g
Garlic Butter Hilopites with Spinach
comfortsimplegreekmediterraneanvegetariancheesecrispytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a large skillet over medium-high heat. Add hilopites and cook, stirring constantly, until toasted and golden, ~5 minutes.

  2. Step 2

    Add butter and minced garlic. Stir constantly until fragrant, about 30 seconds — don't let the garlic brown.

  3. Step 3

    Add 1.5 cups water and a pinch of salt. Bring to a simmer and cook uncovered until pasta is tender and water mostly absorbs, ~4 minutes.

  4. Step 4

    Pile spinach on top of the pasta and stir until just wilted, about 60 seconds.

  5. Step 5

    Remove from heat. Squeeze lemon juice over the top and stir gently to combine.

  6. Step 6

    Divide between bowls and scatter feta over each serving. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.