Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Lime Shrimp Quesadilla

Pan-seared shrimp with lime tossed between melted Monterey Jack and warm flour tortillas, sliced into crispy wedges. Serve with chips, salsa, sour cream, and guacamole for the full spread.

Total time
15 min
Servings
2
Calories
385
Protein
24g
Crispy Lime Shrimp Quesadilla
quickcasualmexicanshrimpcrispymeltyweeknightquesadilla

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Cook shrimp, stirring occasionally, until pink and cooked through, about 4 minutes.

  3. Step 3

    Squeeze lime juice over shrimp and toss to coat, then transfer to a plate.

  4. Step 4

    Place one tortilla in the skillet, sprinkle half the cheese, add the shrimp, then top with remaining cheese and the second tortilla.

  5. Step 5

    Cook until golden and crispy (~2 min), flip, then cook the other side until golden (~2 min).

  6. Step 6

    Slide onto a cutting board and cut into wedges, then serve with chips, salsa, sour cream, and guacamole.

Tools you’ll need

  • 10-inch skillet
  • cutting board
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.