Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Parmesan Chicken with Broccoli

Breaded chicken breast crusted with parmesan and breadcrumbs, pan-fried until golden, served alongside roasted broccoli and a simple side salad. Ready in 25 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
48g
Crispy Parmesan Chicken with Broccoli
satisfyingcomfortitalianchickencrispytenderweeknightmain-dish

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry, then place between plastic wrap and pound to 1/2-inch thickness.

  2. Step 2

    Mix breadcrumbs and parmesan in a shallow bowl, season with salt and pepper.

  3. Step 3

    Coat each chicken piece in the breadcrumb mixture, pressing gently so it adheres.

  4. Step 4

    Heat 2 tbsp oil in a 12-inch skillet over medium-high until shimmering, about 90 seconds.

  5. Step 5

    Sear chicken 5–6 minutes per side until golden brown and cooked through (165°F internal temp).

  6. Step 6

    Meanwhile, toss broccoli with 1 tbsp oil, salt, and pepper on a sheet pan, roast at 425°F for 12 minutes.

Tools you’ll need

  • 12-inch skillet
  • shallow bowl
  • sheet pan
  • plastic wrap
  • meat mallet or rolling pin
  • instant-read thermometer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.