CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Parmesan Chicken with Broccoli

Breaded chicken breast crusted with parmesan and breadcrumbs, pan-fried until golden, served alongside roasted broccoli and a simple side salad. Ready in 25 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
48g
Crispy Parmesan Chicken with Broccoli
satisfyingcomfortitalianchickencrispytenderweeknightmain-dish

Ingredients

  • 2 pieces (about 6 oz each) chicken breast
  • ½ cup breadcrumbs
  • ⅓ cup parmesan cheese, grated
  • 1 lb broccoli florets

Instructions

  1. 1

    Pat chicken dry, then place between plastic wrap and pound to 1/2-inch thickness.

  2. 2

    Mix breadcrumbs and parmesan in a shallow bowl, season with salt and pepper.

  3. 3

    Coat each chicken piece in the breadcrumb mixture, pressing gently so it adheres.

  4. 4

    Heat 2 tbsp oil in a 12-inch skillet over medium-high until shimmering, about 90 seconds.

  5. 5

    Sear chicken 5–6 minutes per side until golden brown and cooked through (165°F internal temp).

  6. 6

    Meanwhile, toss broccoli with 1 tbsp oil, salt, and pepper on a sheet pan, roast at 425°F for 12 minutes.

Tools you’ll need

  • 12-inch skillet
  • shallow bowl
  • sheet pan
  • plastic wrap
  • meat mallet or rolling pin
  • instant-read thermometer

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.