Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pineapple Fried Rice

Cooked rice, pineapple, and mixed protein tossed in a hot skillet with soy and sesame oil. Crunchy, sweet, savory, and done in 15 minutes.

Total time
15 min
Servings
4
Calories
420
Protein
28g
Crispy Pineapple Fried Rice
quicksatisfyinghawaiianchickenshrimpcrispytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp neutral oil in a 12-inch skillet over high heat until it shimmers, ~90 seconds.

  2. Step 2

    Add shrimp and cook 2–3 minutes without stirring until bottoms turn pink, then stir and remove to a plate.

  3. Step 3

    Add rice to the same skillet, breaking up any clumps, and stir constantly until edges curl and surface looks dry, ~3 minutes.

  4. Step 4

    Pour soy sauce and sesame oil over the rice, add chicken and pineapple, and toss until everything is hot and coated, ~2 minutes.

  5. Step 5

    Return shrimp to the skillet and toss once to combine.

  6. Step 6

    Serve in bowls topped with scallions and crushed peanuts.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon or spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.