CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pineapple Fried Rice

Cooked rice, pineapple, and mixed protein tossed in a hot skillet with soy and sesame oil. Crunchy, sweet, savory, and done in 15 minutes.

Total time
15 min
Servings
4
Calories
420
Protein
28g
Crispy Pineapple Fried Rice
quicksatisfyinghawaiianchickenshrimpcrispytenderweeknight

Ingredients

  • 3 cups cooked rice, chilled or room temperature
  • 1.5 cups rotisserie chicken, shredded
  • ½ cup frozen shrimp, thawed and patted dry
  • 1 cup fresh pineapple, cut into 0.5-inch chunks
  • 3 tbsp soy sauce
  • 2 tsp sesame oil
  • ½ cup scallions, chopped
  • ¼ cup roasted peanuts, crushed

Instructions

  1. 1

    Heat 2 tbsp neutral oil in a 12-inch skillet over high heat until it shimmers, ~90 seconds.

  2. 2

    Add shrimp and cook 2–3 minutes without stirring until bottoms turn pink, then stir and remove to a plate.

  3. 3

    Add rice to the same skillet, breaking up any clumps, and stir constantly until edges curl and surface looks dry, ~3 minutes.

  4. 4

    Pour soy sauce and sesame oil over the rice, add chicken and pineapple, and toss until everything is hot and coated, ~2 minutes.

  5. 5

    Return shrimp to the skillet and toss once to combine.

  6. 6

    Serve in bowls topped with scallions and crushed peanuts.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon or spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.