Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Podi Dosa

Golden-brown dosa with spicy peanut-lentil powder crust. Vegan, quick, and pure comfort — ready in 20 minutes with pantry staples.

Total time
20 min
Servings
2
Calories
420
Protein
12g
Crispy Podi Dosa
comfortquickindianvegetarianvegandairy-freechickpeascrispy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix crushed peanuts, red chili, urad dal powder, and a pinch of salt in a bowl.

  2. Step 2

    Heat oil in a nonstick skillet over medium-high until it shimmers and a drop of batter sizzles instantly.

  3. Step 3

    Pour 1/2 cup batter onto the skillet, spread it into a thin circle with the back of a spoon.

  4. Step 4

    Sprinkle a thick line of podi mixture down the center, press gently so it sticks to the dosa.

  5. Step 5

    Cook until the bottom is golden and crispy, ~3 minutes, then flip and cook the other side for 1 minute until golden.

  6. Step 6

    Fold in half and serve hot with chutney on the side.

Tools you’ll need

  • 12-inch nonstick skillet or cast iron dosa pan
  • spoon or silicone spatula
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.