Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pretzel Sticks with Hot Mustard

Golden, salty pretzel sticks with a tender crumb inside, baked until edges curl. Serve warm with sharp mustard for dipping—authentic German laugen flavor in 20 minutes, no yeast required.

Total time
20 min
Servings
4
Calories
180
Protein
5g
Crispy Pretzel Sticks with Hot Mustard
simplecasualgermanvegetariancrispytenderweeknightsnack

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and baking soda in a bowl, then add water and stir until a shaggy dough forms.

  2. Step 2

    Knead on a counter for 2 minutes until smooth. Divide into 12 pieces and roll each into a 6-inch stick.

  3. Step 3

    Dissolve 1 tbsp baking soda in 1 cup boiling water. Dip each stick 10 seconds per side until edges look slightly translucent.

  4. Step 4

    Lay sticks on a parchment-lined sheet pan. Sprinkle with coarse salt and caraway seeds if using.

  5. Step 5

    Bake at 425°F until deep golden brown and edges feel crisp, 10–12 minutes.

  6. Step 6

    Cool 2 minutes on the pan. Serve warm with whole-grain mustard for dipping.

Tools you’ll need

  • large mixing bowl
  • measuring cups and spoons
  • sheet pan
  • parchment paper
  • shallow dipping bowl (for baking soda bath)
  • oven
  • kitchen counter or cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.