Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Sambusa with Cabbage & Chili

Golden fried pastry triangles filled with spiced beef, served alongside cool shredded cabbage and fresh chili peppers. Ready in 20 minutes with store-bought phyllo or wonton wrappers.

Total time
20 min
Servings
2
Calories
520
Protein
24g
Crispy Sambusa with Cabbage & Chili
casualindulgentethiopianbeefcrispytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Brown ground beef in a skillet over medium-high with minced onion and half the chili, breaking up meat, ~5 minutes. Season with salt and pepper, then cool slightly.

  2. Step 2

    Lay one wrapper flat. Place 1 tbsp beef filling in the lower-left corner and fold into a triangle, sealing edges with a dab of water.

  3. Step 3

    Heat 2 tbsp oil in a large skillet over medium-high. Pan-fry triangles in batches, ~90 seconds per side, until golden and crispy.

  4. Step 4

    Toss cabbage with remaining minced chili and a pinch of salt. Serve sambusas hot with the cabbage slaw on the side.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.