Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Shrimp Soba

Tender soba noodles in a hot dashi broth, topped with crispy panko shrimp and a soft egg. Dinner in under 10 minutes.

Total time
10 min
Servings
2
Calories
412
Protein
32g
Crispy Shrimp Soba
quickcomfortjapaneseshrimpcrispytendersilkyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring dashi and soy sauce to a simmer in a large pot over medium-high heat.

  2. Step 2

    Pat shrimp dry. Toss with salt, pepper, then coat in panko. Heat oil in a skillet over medium-high until shimmering.

  3. Step 3

    Sear panko shrimp 90 seconds per side until edges turn golden. Transfer to a plate.

  4. Step 4

    Add soba to the simmering broth, stir gently, and boil 3–4 minutes until tender.

  5. Step 5

    Crack both eggs into the broth at opposite ends. Let whites set but yolks stay runny, about 2 minutes.

  6. Step 6

    Pour noodles and broth into two bowls. Top each with shrimp, one egg, and scallion. Serve hot.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • tongs
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.