Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Tempura Soba with Shrimp & Veggies

Crispy-fried shrimp and vegetables over chewy buckwheat noodles in a warm dashi-inspired broth. A restaurant-quality dinner that feels fast because the frying is the only real time commitment.

Total time
25 min
Servings
2
Calories
620
Protein
18g
25-Min Tempura Soba with Shrimp & Veggies
satisfyingcomfortjapaneseshrimpcrispychewytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil to 350°F in a heavy-bottomed pot or deep skillet using a thermometer. Pat shrimp and vegetables completely dry.

  2. Step 2

    Mix 0.5 cup flour with cold water to make a thin batter the consistency of heavy cream. Season with a pinch of salt.

  3. Step 3

    Dredge shrimp and vegetables lightly in remaining flour, then dip into batter and drop carefully into hot oil. Fry in batches without crowding.

  4. Step 4

    Cook until golden and crispy, 2-3 minutes per batch. Lift out with a slotted spoon onto a paper-towel-lined plate.

  5. Step 5

    Boil soba noodles in salted water until al dente, about 4 minutes. Drain and divide between two bowls.

  6. Step 6

    Heat broth with soy sauce until steaming, then pour over noodles. Top with hot tempura and serve immediately.

Tools you’ll need

  • heavy-bottomed pot or deep 12-inch skillet
  • instant-read thermometer
  • slotted spoon
  • paper towels
  • two bowls
  • small mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.