Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Tempura Soba with Shrimp & Crispy Veg

Buckwheat noodles in a hot dashi broth topped with crispy shrimp and vegetable tempura, plus cool grated daikon. Restaurant-quality in under 20 minutes using a dashi-paste shortcut.

Total time
20 min
Servings
2
Calories
520
Protein
24g
20-Min Tempura Soba with Shrimp & Crispy Veg
satisfyingelegantjapaneseshrimpcrispytenderchewyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a pot of salted water to a boil. Add soba noodles and cook until tender, ~4 minutes. Drain, rinse briefly with cold water, and set aside.

  2. Step 2

    In the same pot, bring 4 cups water to a boil. Whisk in dashi paste until dissolved. Season lightly with salt—dashi carries enough umami.

  3. Step 3

    Heat oil in a deep skillet to 350°F (test by dropping a flour pinch—it should sizzle immediately). Pat shrimp and veg dry on paper towels.

  4. Step 4

    Mix flour with cold water to form a thin batter (no lumps needed—rustic batter is fine). Dip shrimp and vegetables, then fry 2-3 minutes until golden and crispy. Drain on paper towels.

  5. Step 5

    Divide cooked soba between two bowls. Ladle hot dashi over the noodles until half-full. Top with crispy tempura and a mound of grated daikon.

  6. Step 6

    Serve immediately. Dip tempura or noodles into the dashi before eating—the daikon cuts the richness of the fried coating.

Tools you’ll need

  • large pot
  • deep skillet or small wok
  • instant-read thermometer or deep-fry thermometer
  • slotted spoon or spider strainer
  • paper towels
  • two serving bowls
  • microplane or box grater for daikon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.