Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Spicy Shrimp Dynamite Roll

Tempura shrimp tossed in a fiery mayo-sriracha glaze, served over sushi rice with avocado and cucumber. One skillet, 20 minutes, pure sushi-bar energy.

Total time
20 min
Servings
2
Calories
520
Protein
24g
Crispy Spicy Shrimp Dynamite Roll
indulgentsatisfyingjapaneseshrimpcrispytendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix sriracha, mayo, and 1 tbsp soy sauce in a small bowl until smooth.

  2. Step 2

    Pat shrimp dry. Toss with flour, salt, and pepper until evenly coated.

  3. Step 3

    Heat 1 inch of neutral oil in a skillet to 350°F. Working in two batches, fry shrimp until golden and crispy, about 2 minutes per batch.

  4. Step 4

    Transfer fried shrimp to paper towels. Toss with the sriracha mayo while still warm.

  5. Step 5

    Divide sushi rice between two bowls. Top with glazed shrimp, avocado slices, and a drizzle of extra sauce.

  6. Step 6

    Serve immediately with extra soy sauce on the side.

Tools you’ll need

  • 9-inch skillet or small saucepan
  • candy/deep-fry thermometer
  • paper towels
  • small mixing bowl
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.