Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Spinach & Feta Borek

Buttery phyllo wrapped around seasoned spinach and crumbly feta, pan-fried until golden and shatteringly crisp. Turkish comfort food that feels fancy but takes 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
12g
Crispy Spinach & Feta Borek
comfortelegantturkishvegetariancheesecrispyflakyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp butter in a large skillet over medium. Add minced onion and cook until soft, about 2 minutes.

  2. Step 2

    Add spinach and stir constantly until wilted and any moisture evaporates, about 3 minutes. Remove from heat.

  3. Step 3

    Fold feta and fresh dill into the spinach mixture. Season with salt and pepper to taste. Let cool 2 minutes.

  4. Step 4

    Lay one phyllo sheet on a cutting board. Brush lightly with melted butter. Spoon 2 tbsp spinach mixture along one short edge.

  5. Step 5

    Roll the phyllo tightly around the filling into a log. Repeat with remaining sheets and filling to make 6 boreks.

  6. Step 6

    Heat remaining 3 tbsp butter in the same skillet over medium-high. Fry boreks 2–3 minutes per side until golden and crisp. Serve immediately.

Tools you’ll need

  • large skillet (10–12 inch)
  • cutting board
  • spoon
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.