Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Spinach Fatayer

Flaky, golden Lebanese spinach triangles filled with garlicky wilted spinach, sumac, and pine nuts. Ready in under 30 minutes using store-bought phyllo for maximum TikTok ease.

Total time
25 min
Servings
4
Calories
312
Protein
8g
Crispy Spinach Fatayer
comfortelegantlebanesevegetarianvegetariancrispyflakytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp olive oil in a large skillet over medium. Add diced onion, cook until softened, ~3 minutes.

  2. Step 2

    Add minced garlic, cook 30 seconds until fragrant, then add spinach in handfuls, stirring until fully wilted, ~4 minutes.

  3. Step 3

    Drain spinach in a fine-mesh sieve, pressing gently. Transfer to a bowl, fold in pine nuts, sumac, lemon juice, salt, and pepper.

  4. Step 4

    Brush a phyllo sheet lightly with olive oil, fold in half to form a rectangle, brush again, then place 2 tbsp spinach filling on one corner.

  5. Step 5

    Fold phyllo into a triangle around the filling, sealing edges. Repeat with remaining sheets and filling. Arrange on a sheet pan, brush tops with remaining oil.

  6. Step 6

    Bake at 375°F for 12–14 minutes until golden and crispy. Serve warm.

Tools you’ll need

  • large skillet
  • fine-mesh sieve
  • mixing bowl
  • sheet pan
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.