CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Spinach Fatayer

Flaky, golden Lebanese spinach triangles filled with garlicky wilted spinach, sumac, and pine nuts. Ready in under 30 minutes using store-bought phyllo for maximum TikTok ease.

Total time
25 min
Servings
4
Calories
312
Protein
8g
Crispy Spinach Fatayer
comfortelegantlebanesevegetarianvegetariancrispyflakytender

Ingredients

  • 10 oz fresh spinach, packed
  • 8 sheets phyllo dough sheets
  • 5 tbsp olive oil
  • ½ medium onion, diced small
  • 3 cloves garlic, minced
  • ¼ cup pine nuts, toasted
  • 1 tsp sumac
  • ½ whole lemon, juiced

Instructions

  1. 1

    Heat 2 tbsp olive oil in a large skillet over medium. Add diced onion, cook until softened, ~3 minutes.

  2. 2

    Add minced garlic, cook 30 seconds until fragrant, then add spinach in handfuls, stirring until fully wilted, ~4 minutes.

  3. 3

    Drain spinach in a fine-mesh sieve, pressing gently. Transfer to a bowl, fold in pine nuts, sumac, lemon juice, salt, and pepper.

  4. 4

    Brush a phyllo sheet lightly with olive oil, fold in half to form a rectangle, brush again, then place 2 tbsp spinach filling on one corner.

  5. 5

    Fold phyllo into a triangle around the filling, sealing edges. Repeat with remaining sheets and filling. Arrange on a sheet pan, brush tops with remaining oil.

  6. 6

    Bake at 375°F for 12–14 minutes until golden and crispy. Serve warm.

Tools you’ll need

  • large skillet
  • fine-mesh sieve
  • mixing bowl
  • sheet pan
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.