Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Feta Cheese Pies

Buttery phyllo triangles stuffed with creamy feta and fresh herbs, baked until golden in under 20 minutes. A Greek classic that feels fancy but tastes like TikTok comfort.

Total time
18 min
Servings
4
Calories
285
Protein
9g
Crispy Feta Cheese Pies
elegantsimplegreekvegetariancheesecrispycreamyflaky

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F. Mix feta, dill, parsley, egg, and pepper in a bowl until combined.

  2. Step 2

    Place one phyllo sheet on a cutting board. Brush lightly with melted butter.

  3. Step 3

    Cut the phyllo into 4 strips lengthwise. Place 1 tbsp filling on the lower left corner of each strip.

  4. Step 4

    Fold the bottom-left corner up and to the right to form a triangle, then keep folding up until you reach the end of the strip.

  5. Step 5

    Place folded triangles seam-side down on a sheet pan. Brush all pies with remaining butter.

  6. Step 6

    Bake until golden brown and crispy, 12–14 minutes. Serve warm.

Tools you’ll need

  • sheet pan
  • cutting board
  • small mixing bowl
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.