Custrd is out on the App Store — Download it free →
Back to recipes

Falafel Bowl

A hearty and colorful bowl with crispy falafel, fluffy rice, roasted vegetables, and fresh veggies. Perfect for a quick and satisfying meal.

Total time
35 min
Servings
4
Calories
450
Protein
15g
Falafel Bowl
comfortinghealthymiddle easternveganvegetariandairy-freechickpeacrispy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Slice bell peppers and onion into strips, toss with 1 tbsp olive oil, salt, and pepper.

  2. Step 2

    Roast vegetables on a baking sheet for 20-25 minutes until tender and lightly charred.

  3. Step 3

    While vegetables roast, cook falafel according to package instructions (bake or fry until crispy).

  4. Step 4

    Drain and rinse chickpeas; pat dry. In a skillet, heat 1 tbsp olive oil over medium-high, add chickpeas and cook until slightly crispy, about 5 minutes.

  5. Step 5

    Chop tomatoes and cucumber into bite-sized pieces.

  6. Step 6

    Assemble bowls: divide rice among 4 bowls, top with roasted vegetables, chickpeas, falafel, tomatoes, and cucumber.

  7. Step 7

    Drizzle with tahini or yogurt sauce if desired, and serve warm.

Tools you’ll need

  • baking sheet
  • skillet
  • knife
  • cutting board
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.