Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Focaccia di Recco

Paper-thin, crispy layers of dough with melted cheese and herbs—a Ligurian classic. This stretched dough requires patience but rewards you with an addictively light, savory focaccia.

Total time
75 min
Servings
4
Calories
520
Protein
14g
Focaccia di Recco
rusticelegantitalianvegetariancheesecrispyflakymelty

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour, yeast, and salt in a large bowl. Pour warm water and 2 tbsp olive oil into the center.

  2. Step 2

    Stir with a wooden spoon until shaggy dough forms, then knead by hand until smooth, ~8 minutes.

  3. Step 3

    Oil a large bowl with remaining 2 tbsp olive oil. Place dough inside, cover with plastic wrap.

  4. Step 4

    Let rise in a warm place until doubled in size, 45–60 minutes, until you can see bubbles.

  5. Step 5

    Preheat oven to 400°F. Oil a 12-by-16-inch baking sheet generously with olive oil.

  6. Step 6

    Turn dough onto the oiled sheet. Gently stretch it with oiled hands until it covers the sheet.

  7. Step 7

    Tear stracchino into small pieces and scatter over dough. Sprinkle rosemary and black pepper.

  8. Step 8

    Fold dough in half over itself twice to create layers—don't worry if it tears slightly.

  9. Step 9

    Bake until the top is deep golden brown and edges are crispy, 18–22 minutes.

  10. Step 10

    Cool on the sheet for 3 minutes, then slide onto a wire rack or serving board.

  11. Step 11

    Drizzle with olive oil if desired. Serve warm or at room temperature.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • plastic wrap
  • 12-by-16-inch baking sheet
  • oven
  • wire rack or cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.