Custrd is out on the App Store — Download it free →
Back to recipes

Fried Fish with Lime and Onion Salad

A quick and flavorful whole fried fish topped with a bright lime and onion salad, served with crispy plantains. Perfect for a weeknight dinner that feels special.

Total time
25 min
Servings
2
Calories
650
Protein
35g
Fried Fish with Lime and Onion Salad
comfortinglatingluten-freefishcrispytenderweeknightmain

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 1 whole fish dry with paper towels. Score the skin on both sides with shallow cuts. Season generously with 1 tsp salt, inside and out.

  2. Step 2

    Heat 0.5 cup vegetable oil in a large skillet over medium-high heat until shimmering. Carefully place the fish in the hot oil and fry until golden and crisp, about 5-7 minutes per side. The fish should flake easily with a fork when done.

  3. Step 3

    While the fish cooks, peel and slice 2 plantains into 0.5 inch rounds. In a separate pan, heat 2 tbsp of the oil from the fish skillet over medium heat and fry the plantains until golden and tender, about 3-4 minutes per side. Drain on paper towels.

  4. Step 4

    Thinly slice 1 red onion and place in a bowl. Squeeze the juice of 2 limes over the onion and toss with a pinch of salt. Let it sit for 5 minutes to mellow the onion.

  5. Step 5

    Serve the fried fish hot, topped with the lime-pickled onions and crispy plantains on the side. Squeeze extra lime over everything before eating.

Tools you’ll need

  • large skillet
  • second skillet or saucepan
  • knife
  • cutting board
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.