Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Minute Garlic Knots

Refrigerated biscuit dough twisted into knots, brushed with garlicky butter, and baked until golden and glossy. A crispy-outside snack that hits in under 15 minutes.

Total time
15 min
Servings
4
Calories
215
Protein
4g
15-Minute Garlic Knots
comfortsimpleamericanvegetariancrispyfluffysnackweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F and line a sheet pan with parchment paper.

  2. Step 2

    Separate each biscuit and roll into a thin rope, then tie into a loose knot.

  3. Step 3

    Melt butter in a small bowl, stir in minced garlic and parsley until fragrant.

  4. Step 4

    Brush each knot generously with the garlic butter on both sides.

  5. Step 5

    Bake 8–10 minutes until golden brown and glossy on top.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.