CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Minute Garlic Knots

Refrigerated biscuit dough twisted into knots, brushed with garlicky butter, and baked until golden and glossy. A crispy-outside snack that hits in under 15 minutes.

Total time
15 min
Servings
4
Calories
215
Protein
4g
15-Minute Garlic Knots
comfortsimpleamericanvegetariancrispyfluffysnackweeknight

Ingredients

  • 1 can (8 biscuits) refrigerated biscuit dough
  • 3 tbsp butter
  • 3 cloves garlic, minced
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Preheat oven to 400°F and line a sheet pan with parchment paper.

  2. 2

    Separate each biscuit and roll into a thin rope, then tie into a loose knot.

  3. 3

    Melt butter in a small bowl, stir in minced garlic and parsley until fragrant.

  4. 4

    Brush each knot generously with the garlic butter on both sides.

  5. 5

    Bake 8–10 minutes until golden brown and glossy on top.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.