15-Minute Garlic Knots
Refrigerated biscuit dough twisted into knots, brushed with garlicky butter, and baked until golden and glossy. A crispy-outside snack that hits in under 15 minutes.
- Total time
- 15 min
- Servings
- 4
- Calories
- 215
- Protein
- 4g

comfortsimpleamericanvegetariancrispyfluffysnackweeknight
Ingredients
- 1 can (8 biscuits) refrigerated biscuit dough
- 3 tbsp butter
- 3 cloves garlic, minced
- 2 tbsp fresh parsley, chopped
Instructions
- 1
Preheat oven to 400°F and line a sheet pan with parchment paper.
- 2
Separate each biscuit and roll into a thin rope, then tie into a loose knot.
- 3
Melt butter in a small bowl, stir in minced garlic and parsley until fragrant.
- 4
Brush each knot generously with the garlic butter on both sides.
- 5
Bake 8–10 minutes until golden brown and glossy on top.
Tools you’ll need
- sheet pan
- parchment paper
- small bowl
- pastry brush
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



