Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tomato Bruschetta

Toasted bread rubbed with garlic and topped with fresh tomatoes, basil, and olive oil. A classic Italian snack ready in 10 minutes.

Total time
10 min
Servings
4
Calories
185
Protein
5g
Tomato Bruschetta
freshsimpleitalianvegetariancrispyjuicyAppetizerparty

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice baguette diagonally into 1/3-inch-thick pieces.

  2. Step 2

    Arrange bread slices on a baking sheet. Broil 3–4 minutes until golden and crispy on both sides, flipping halfway.

  3. Step 3

    Rub each hot slice with cut garlic clove until fragrant.

  4. Step 4

    Dice tomatoes and transfer to a bowl. Chop basil and add with 2 tbsp olive oil, salt, and pepper.

  5. Step 5

    Spoon tomato mixture onto each toast. Drizzle with remaining 1 tbsp olive oil.

  6. Step 6

    Serve immediately while bread is still warm.

Tools you’ll need

  • baking sheet
  • broiler or oven
  • serrated bread knife
  • cutting board
  • chef's knife
  • medium bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.