Girl Dinner Board

A no-cook snack plate loaded with cheese, cured meats, pickles, olives, and crispy crackers — the ultimate "I'm not cooking" dinner. Mix and match everything for endless bites.

Total time: 10 min
Servings: 2
Calories: 380
Protein: 16g

casualsimplecheesecrispycreamyweeknightcasualappetizer

Ingredients

6 items — tap to check off

6 oz mixed cheese (cheddar, brie, or gouda), sliced or cubed
4 oz cured meats (salami, prosciutto, or sopressata), sliced
1 cup mixed olives and pickles (cornichons, pepperoncini)
2 cups crackers (water crackers, seeded, or breadsticks)
1.5 cups fresh fruit (grapes, apple slices, or berries)
2 tbsp hot honey or whole-grain mustard

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

Step 1
Arrange cheese, cured meats, olives, and pickles on a board or large plate.
Step 2
Scatter crackers and fresh fruit around the board, filling in gaps.
Step 3
Drizzle hot honey over the cheese or dollop mustard on the side as a dip.
Step 4
Serve immediately and mix and match as you eat.

Tools you’ll need

cutting board or serving platter
small sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.

Try the free recipe finder

Ingredients

Instructions

Tools you’ll need

Get matched recipes for what’s in your fridge

More recipes like this