Custrd is out on the App Store — Download it free →
Back to recipes

Greek Chicken Salad

A quick and satisfying salad with juicy chicken, fresh spinach, briny olives, and creamy feta, all tied together with a simple lemon-olive oil dressing.

Total time
25 min
Servings
2
Calories
520
Protein
42g
Greek Chicken Salad
freshsatisfyinggreekgluten-freechickencrispcreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Season the 2 chicken breasts with salt and pepper. Heat 1 tbsp olive oil in a skillet over medium-high heat and cook the chicken until golden and cooked through, about 6-7 minutes per side. Let rest, then slice.

  2. Step 2

    In a large bowl, combine the 6 cups baby spinach, 1 cup cherry tomatoes (halved), and 1/2 cup kalamata olives.

  3. Step 3

    Whisk together the remaining 2 tbsp olive oil and the juice of the lemon in a small bowl. Season with salt and pepper.

  4. Step 4

    Pour the dressing over the salad and toss to coat evenly.

  5. Step 5

    Top with the sliced chicken and crumble the 1/2 cup feta over the salad. Garnish with lemon zest if desired.

Tools you’ll need

  • skillet
  • large bowl
  • small bowl
  • whisk
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.