CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Greek Village Salad with Feta & Olives

Crisp tomatoes, cucumber, peppers, and creamy feta tossed with briny olives in a lemon-olive oil dressing. A bright, no-cook meal that tastes like a Greek island escape.

Total time
10 min
Servings
2
Calories
312
Protein
9g
Greek Village Salad with Feta & Olives
freshlightsimplegreekvegetariangluten-freecheesecrisp

Ingredients

  • 2 cups cherry tomatoes, halved
  • 1 large cucumber, diced into 1/2-inch pieces
  • 1 medium yellow bell pepper, diced into 1/2-inch pieces
  • 1 medium green bell pepper, diced into 1/2-inch pieces
  • ¾ cup Kalamata olives, pitted
  • ¾ cup feta cheese, crumbled
  • 1 whole lemon (juiced)
  • 3 tbsp olive oil

Instructions

  1. 1

    Halve the cherry tomatoes and dice the cucumber and both peppers into 1/2-inch chunks.

  2. 2

    Add all diced vegetables, olives, and feta to a large bowl.

  3. 3

    Whisk together lemon juice, olive oil, salt, and pepper in a small bowl until combined.

  4. 4

    Pour the dressing over the salad and toss gently until all vegetables are coated.

  5. 5

    Let sit for 2 minutes so the flavors meld, then taste and adjust seasoning.

  6. 6

    Serve immediately or chill up to 1 hour before eating.

Tools you’ll need

  • cutting board
  • chef's knife
  • large mixing bowl
  • small mixing bowl
  • whisk
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.