Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Greek Village Salad with Feta & Olives

Crisp tomatoes, cucumber, peppers, and creamy feta tossed with briny olives in a lemon-olive oil dressing. A bright, no-cook meal that tastes like a Greek island escape.

Total time
10 min
Servings
2
Calories
312
Protein
9g
Greek Village Salad with Feta & Olives
freshlightsimplegreekvegetariangluten-freecheesecrisp

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Halve the cherry tomatoes and dice the cucumber and both peppers into 1/2-inch chunks.

  2. Step 2

    Add all diced vegetables, olives, and feta to a large bowl.

  3. Step 3

    Whisk together lemon juice, olive oil, salt, and pepper in a small bowl until combined.

  4. Step 4

    Pour the dressing over the salad and toss gently until all vegetables are coated.

  5. Step 5

    Let sit for 2 minutes so the flavors meld, then taste and adjust seasoning.

  6. Step 6

    Serve immediately or chill up to 1 hour before eating.

Tools you’ll need

  • cutting board
  • chef's knife
  • large mixing bowl
  • small mixing bowl
  • whisk
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.