Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Greek Salad with Crispy Cheese & Fish Roe

A shareable Greek feast: juicy tomatoes, cool cucumbers, and creamy feta tossed in oregano-lemon dressing, topped with golden-fried saganaki cheese and briny taramosalata. Fresh, salty, and entirely no-cook except for the cheese.

Total time
18 min
Servings
2
Calories
485
Protein
22g
Greek Salad with Crispy Cheese & Fish Roe
freshcasuallightgreekvegetariancheesecrispycreamy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut tomatoes into wedges, cucumber into half-moons. Crumble feta into bite-size chunks.

  2. Step 2

    Heat olive oil in a skillet over medium-high until it shimmers, about 1 minute.

  3. Step 3

    Slice saganaki into 1/4-inch planks. Fry 90 seconds per side until golden and crispy.

  4. Step 4

    Toss tomatoes, cucumber, feta, and olives in a large bowl with juice of half the lemon, oregano, salt, and pepper.

  5. Step 5

    Divide salad between plates. Top each with a piece of warm fried cheese and a dollop of taramosalata.

  6. Step 6

    Drizzle with olive oil and remaining lemon juice. Serve immediately.

Tools you’ll need

  • cutting board
  • chef's knife
  • large mixing bowl
  • 12-inch skillet
  • slotted spatula
  • lemon juicer or fork
  • serving plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.