Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Horiatiki — Crispy Feta Greek Salad

The ultimate TikTok salad: juicy tomatoes, snappy cucumber, briny olives, and a slab of crispy pan-fried feta that steals the show. Five minutes of prep, zero cooking required except the feta.

Total time
12 min
Servings
2
Calories
320
Protein
12g
Horiatiki — Crispy Feta Greek Salad
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut tomatoes into wedges and cucumber into thick half-moons. Slice red onion paper-thin.

  2. Step 2

    Heat 1 tbsp olive oil in a skillet over medium-high heat until shimmering.

  3. Step 3

    Cut feta into a 1-inch-thick slab. Sear it 90 seconds per side until edges turn golden and crispy.

  4. Step 4

    Arrange tomatoes, cucumber, onion, and olives on a plate. Whisk remaining 2 tbsp oil with vinegar and oregano.

  5. Step 5

    Drizzle dressing over vegetables. Top with the crispy feta slab and serve immediately.

Tools you’ll need

  • chef's knife
  • cutting board
  • 10-inch skillet
  • small bowl
  • whisk
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.