Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Greek Village Salad with Crispy Feta

Tomato, cucumber, olives, and creamy feta tossed with a bright lemon-olive oil dressing. Ready in 10 minutes — no cooking required, just chopping and tossing.

Total time
10 min
Servings
2
Calories
285
Protein
8g
Greek Village Salad with Crispy Feta
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut tomatoes into quarters. Slice cucumber into 1/2-inch rounds.

  2. Step 2

    Tear feta into large chunks. Combine tomatoes, cucumber, olives, and feta in a bowl.

  3. Step 3

    Squeeze lemon juice over the salad. Drizzle with olive oil, then season with salt and pepper.

  4. Step 4

    Toss gently until everything is coated and the dressing pooled at the bottom looks glossy.

  5. Step 5

    Let sit 2 minutes for flavors to meld, then serve at room temperature.

Tools you’ll need

  • cutting board
  • chef's knife
  • large mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.