Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Horiatiki: Greek Village Salad with Barley Rusks

Juicy tomatoes, crisp cucumber, creamy feta, and briny olives tossed with a sharp lemon-olive oil dressing. Serve with chewy barley rusks for dipping.

Total time
15 min
Servings
2
Calories
285
Protein
8g
Horiatiki: Greek Village Salad with Barley Rusks
freshlightsimplegreekvegetariangluten-freecheesecrispy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut tomatoes into bite-sized chunks, removing excess seeds and juice. Transfer to a bowl.

  2. Step 2

    Cut cucumber into half-moons about 1/4-inch thick. Add to the bowl with tomatoes.

  3. Step 3

    Add olives, red onion, and crumbled feta to the bowl.

  4. Step 4

    Whisk together olive oil and lemon juice with a pinch of salt and black pepper.

  5. Step 5

    Pour dressing over the salad and toss gently until everything is coated.

  6. Step 6

    Divide between plates or bowls. Serve immediately with barley rusks for dipping.

Tools you’ll need

  • cutting board
  • sharp knife
  • large bowl
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.