CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Horiatiki: Greek Village Salad with Barley Rusks

Juicy tomatoes, crisp cucumber, creamy feta, and briny olives tossed with a sharp lemon-olive oil dressing. Serve with chewy barley rusks for dipping.

Total time
15 min
Servings
2
Calories
285
Protein
8g
Horiatiki: Greek Village Salad with Barley Rusks
freshlightsimplegreekvegetariangluten-freecheesecrispy

Ingredients

  • 3 whole tomatoes (ripe, large)
  • 1 whole cucumber (English or Persian)
  • 6 oz feta cheese, crumbled
  • ¾ cup Kalamata olives, pitted
  • ¼ cup red onion, thinly sliced
  • 3 tbsp olive oil
  • 2 tbsp lemon juice
  • 4 whole barley rusks (paximadi)

Instructions

  1. 1

    Cut tomatoes into bite-sized chunks, removing excess seeds and juice. Transfer to a bowl.

  2. 2

    Cut cucumber into half-moons about 1/4-inch thick. Add to the bowl with tomatoes.

  3. 3

    Add olives, red onion, and crumbled feta to the bowl.

  4. 4

    Whisk together olive oil and lemon juice with a pinch of salt and black pepper.

  5. 5

    Pour dressing over the salad and toss gently until everything is coated.

  6. 6

    Divide between plates or bowls. Serve immediately with barley rusks for dipping.

Tools you’ll need

  • cutting board
  • sharp knife
  • large bowl
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.