Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Greek Village Salad with Tzatziki

Crisp tomatoes, cucumbers, olives, and creamy feta tossed with a bright olive oil and vinegar dressing, served with cool tzatziki on the side. No cooking required—just chop, toss, and pour a glass of rosé.

Total time
10 min
Servings
2
Calories
340
Protein
12g
Greek Village Salad with Tzatziki
freshlightsimplegreekvegetariangluten-freecheesecrispy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Core the tomatoes and chop them into 1-inch chunks. Cut the cucumber into half-moons about 1/4-inch thick.

  2. Step 2

    Transfer tomatoes and cucumber to a large bowl. Add the Kalamata olives and crumbled feta.

  3. Step 3

    Drizzle with olive oil and red wine vinegar. Season with salt and pepper to taste, then toss gently until just coated.

  4. Step 4

    Divide the salad between two plates. Dollop tzatziki on the side and serve immediately with rosé.

Tools you’ll need

  • large mixing bowl
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.