Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Green Rice Chicken with Crispy Onions & Crema

Peruvian-style cilantro-infused rice topped with pan-seared chicken, finished with tangy pickled onions and cool crema. Complete weeknight dinner in under 30 minutes.

Total time
28 min
Servings
2
Calories
520
Protein
38g
Green Rice Chicken with Crispy Onions & Crema
freshsatisfyingperuvianchickentendercrispyweeknightmain-dish

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Season chicken breasts with salt and pepper on both sides.

  2. Step 2

    Heat oil in a large skillet over medium-high. Sear chicken 5-6 minutes per side until golden and cooked through.

  3. Step 3

    Remove chicken and slice it. Toss red onion with lime juice and a pinch of salt; set aside to quick-pickle.

  4. Step 4

    In the same skillet, blend cilantro, broth, salt, and pepper into a paste; stir until fragrant, about 30 seconds.

  5. Step 5

    Add cooked rice to the skillet and toss until evenly coated with cilantro, 2-3 minutes.

  6. Step 6

    Plate green rice, top with sliced chicken, pickled onions, lettuce, and a dollop of crema.

Tools you’ll need

  • large skillet (12-inch)
  • knife and cutting board
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.