CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Green Rice Chicken with Crispy Onions & Crema

Peruvian-style cilantro-infused rice topped with pan-seared chicken, finished with tangy pickled onions and cool crema. Complete weeknight dinner in under 30 minutes.

Total time
28 min
Servings
2
Calories
520
Protein
38g
Green Rice Chicken with Crispy Onions & Crema
freshsatisfyingperuvianchickentendercrispyweeknightmain-dish

Ingredients

  • 2 each chicken breasts, boneless skinless
  • 1.5 cups cooked white rice
  • 1 cup fresh cilantro, packed
  • ½ each red onion, thinly sliced
  • 2 tbsp lime juice
  • ½ cup sour cream or crema
  • 1 cup fresh lettuce (romaine or iceberg), chopped
  • ¼ cup chicken broth or water

Instructions

  1. 1

    Season chicken breasts with salt and pepper on both sides.

  2. 2

    Heat oil in a large skillet over medium-high. Sear chicken 5-6 minutes per side until golden and cooked through.

  3. 3

    Remove chicken and slice it. Toss red onion with lime juice and a pinch of salt; set aside to quick-pickle.

  4. 4

    In the same skillet, blend cilantro, broth, salt, and pepper into a paste; stir until fragrant, about 30 seconds.

  5. 5

    Add cooked rice to the skillet and toss until evenly coated with cilantro, 2-3 minutes.

  6. 6

    Plate green rice, top with sliced chicken, pickled onions, lettuce, and a dollop of crema.

Tools you’ll need

  • large skillet (12-inch)
  • knife and cutting board
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.