Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Grilled Denis Fish with Lemon & Herbs

Whole grilled sea bream (or any firm white fish) brushed with olive oil, garlic, and fresh herbs, finished with charred lemon slices. Israeli-style simplicity that tastes like the Mediterranean.

Total time
18 min
Servings
2
Calories
285
Protein
38g
Grilled Denis Fish with Lemon & Herbs
elegantsimpleisraelimediterraneanfishflakytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat fish dry inside and out with paper towels. Make 3 shallow slashes on each side of the fish.

  2. Step 2

    Mix olive oil, garlic, and chopped herbs in a small bowl. Season with salt and pepper.

  3. Step 3

    Rub the herb oil all over the fish, inside the cavity and on the skin. Slice the lemon into rounds and stuff some inside each fish.

  4. Step 4

    Heat a grill or grill pan over medium-high until very hot, ~3 minutes. Oil the grates lightly to prevent sticking.

  5. Step 5

    Grill fish 6–7 minutes per side without moving until the flesh flakes easily and the skin chars lightly.

  6. Step 6

    Slide onto a plate and squeeze fresh lemon juice over the top. Serve immediately with any charred lemon slices.

Tools you’ll need

  • grill or grill pan
  • paper towels
  • small mixing bowl
  • fish spatula or wide metal spatula
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.