CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Grilled Denis Fish with Lemon & Herbs

Whole grilled sea bream (or any firm white fish) brushed with olive oil, garlic, and fresh herbs, finished with charred lemon slices. Israeli-style simplicity that tastes like the Mediterranean.

Total time
18 min
Servings
2
Calories
285
Protein
38g
Grilled Denis Fish with Lemon & Herbs
elegantsimpleisraelimediterraneanfishflakytenderweeknight

Ingredients

  • 2 fish (1 lb each) whole sea bream or white fish (gutted and scaled)
  • 3 tbsp olive oil
  • 2 cloves garlic, minced
  • 2 tbsp fresh parsley and dill (or other herbs), chopped
  • 1 whole lemon
  • 1 pinch salt and pepper

Instructions

  1. 1

    Pat fish dry inside and out with paper towels. Make 3 shallow slashes on each side of the fish.

  2. 2

    Mix olive oil, garlic, and chopped herbs in a small bowl. Season with salt and pepper.

  3. 3

    Rub the herb oil all over the fish, inside the cavity and on the skin. Slice the lemon into rounds and stuff some inside each fish.

  4. 4

    Heat a grill or grill pan over medium-high until very hot, ~3 minutes. Oil the grates lightly to prevent sticking.

  5. 5

    Grill fish 6–7 minutes per side without moving until the flesh flakes easily and the skin chars lightly.

  6. 6

    Slide onto a plate and squeeze fresh lemon juice over the top. Serve immediately with any charred lemon slices.

Tools you’ll need

  • grill or grill pan
  • paper towels
  • small mixing bowl
  • fish spatula or wide metal spatula
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.