Custrd is out on the App Store — Download it free →
Back to recipes

Grilled Fish with Lemon and Vegetables

A light and healthy weeknight dinner featuring flaky grilled fish served with a colorful medley of sautéed vegetables and a bright lemon-rosemary finish.

Total time
30 min
Servings
4
Calories
320
Protein
35g
Grilled Fish with Lemon and Vegetables
lighthealthymediterraneanpescatarianfishflakytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 4 fish fillets dry and season both sides with salt and pepper. Slice the lemon into wedges and set aside.

  2. Step 2

    Heat 1 tbsp olive oil in a grill pan over medium-high. Place the fish skin-side down and cook until golden and opaque, about 4-5 minutes per side. Remove and keep warm.

  3. Step 3

    While fish cooks, thinly slice the red onion and bell pepper. Halve the cherry tomatoes.

  4. Step 4

    In a large skillet, heat the remaining 2 tbsp olive oil over medium. Add the onion and pepper, cook until softened, about 5 minutes.

  5. Step 5

    Add the tomatoes and spinach, cook until spinach wilts, about 2 minutes. Season with salt and pepper.

  6. Step 6

    Serve the fish over the vegetables, squeeze lemon wedges over everything, and garnish with the rosemary sprig.

Tools you’ll need

  • grill pan
  • large skillet
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.