CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Grilled Peanut Butter Banana Sandwich

Crispy, buttery bread holding melty peanut butter and caramelized banana slices. A 5-minute sweet-salty handheld that tastes like dessert for breakfast or snack.

Total time
5 min
Servings
1
Calories
380
Protein
11g
Grilled Peanut Butter Banana Sandwich
comfortquickamericanvegetarianvegetariancrispysoftmelty

Ingredients

  • 2 slices bread
  • 2 tbsp peanut butter
  • ½ medium banana
  • 1 tbsp butter

Instructions

  1. 1

    Slice the banana into 1/4-inch rounds.

  2. 2

    Spread 1 tbsp peanut butter on each bread slice.

  3. 3

    Layer banana slices on one slice; press the other slice on top, peanut butter side down.

  4. 4

    Heat a skillet over medium-high; melt half the butter in it.

  5. 5

    Lay the sandwich in the pan; cook 90 seconds until golden brown, then flip.

  6. 6

    Cook the other side 90 seconds until golden, then remove and serve hot.

Tools you’ll need

  • medium skillet
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.