Grilled Peanut Butter Banana Sandwich
Crispy, buttery bread holding melty peanut butter and caramelized banana slices. A 5-minute sweet-salty handheld that tastes like dessert for breakfast or snack.
- Total time
- 5 min
- Servings
- 1
- Calories
- 380
- Protein
- 11g

comfortquickamericanvegetarianvegetariancrispysoftmelty
Ingredients
- 2 slices bread
- 2 tbsp peanut butter
- ½ medium banana
- 1 tbsp butter
Instructions
- 1
Slice the banana into 1/4-inch rounds.
- 2
Spread 1 tbsp peanut butter on each bread slice.
- 3
Layer banana slices on one slice; press the other slice on top, peanut butter side down.
- 4
Heat a skillet over medium-high; melt half the butter in it.
- 5
Lay the sandwich in the pan; cook 90 seconds until golden brown, then flip.
- 6
Cook the other side 90 seconds until golden, then remove and serve hot.
Tools you’ll need
- medium skillet
- cutting board
- knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



