Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Grilled Peanut Butter Banana Sandwich

Crispy, buttery bread holding melty peanut butter and caramelized banana slices. A 5-minute sweet-salty handheld that tastes like dessert for breakfast or snack.

Total time
5 min
Servings
1
Calories
380
Protein
11g
Grilled Peanut Butter Banana Sandwich
comfortquickamericanvegetarianvegetariancrispysoftmelty

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the banana into 1/4-inch rounds.

  2. Step 2

    Spread 1 tbsp peanut butter on each bread slice.

  3. Step 3

    Layer banana slices on one slice; press the other slice on top, peanut butter side down.

  4. Step 4

    Heat a skillet over medium-high; melt half the butter in it.

  5. Step 5

    Lay the sandwich in the pan; cook 90 seconds until golden brown, then flip.

  6. Step 6

    Cook the other side 90 seconds until golden, then remove and serve hot.

Tools you’ll need

  • medium skillet
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.