Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Mini Grilled Cheese

Crispy, buttery bread with melted cheese in under 10 minutes. A classic snack scaled down and ready to eat.

Total time
8 min
Servings
2
Calories
280
Protein
9g
Mini Grilled Cheese
comfortquickamericanvegetariancrispymeltysnackweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Butter one side of each bread slice generously. Season the buttered sides lightly with salt and pepper.

  2. Step 2

    Heat a skillet over medium heat. Once hot, place one slice butter-side down and top with one cheese slice.

  3. Step 3

    Cover with a second bread slice, butter-side up. Cook 2 to 3 minutes until the bottom is golden brown.

  4. Step 4

    Flip and cook the other side 1 to 2 minutes until golden and cheese is fully melted. Remove to a plate.

  5. Step 5

    Repeat with remaining bread and cheese to make the second sandwich.

  6. Step 6

    Cut each sandwich in half diagonally. Serve while hot.

Tools you’ll need

  • 8-inch or 10-inch skillet
  • butter knife
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.