Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Grilled Sea Bream with Lemon & Herbs

Whole fish brushed with oil and herbs, grilled until flaky with charred skin. Served with lemon slices for brightness — ready in 15 minutes.

Total time
15 min
Servings
2
Calories
280
Protein
36g
Grilled Sea Bream with Lemon & Herbs
freshsimpleisraelifishflakycrispyweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat fish dry with paper towels inside and out. Score the thickest part of the fish 2-3 times on each side.

  2. Step 2

    Brush fish inside and out with olive oil. Season generously with salt and pepper, then sprinkle herbs inside the cavity.

  3. Step 3

    Heat grill to medium-high (or heat a cast iron skillet over medium-high until smoking). Oil the grate lightly.

  4. Step 4

    Grill fish 5–6 minutes per side without moving — skin should blister and char, flesh should flake at the thickest point.

  5. Step 5

    Transfer to a plate. Slice lemon into thin rounds and serve alongside the fish.

Tools you’ll need

  • grill or 12-inch cast iron skillet
  • tongs
  • paper towels
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.