Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Haemul Jeongol (Seafood Hot Pot)

A simmering Korean seafood and vegetable hot pot with a savory anchovy broth. Cook seafood and vegetables table-side in one bubbling pot, then dip each bite in spicy sauce.

Total time
25 min
Servings
2
Calories
185
Protein
28g
Haemul Jeongol (Seafood Hot Pot)
cozycomfortkoreanshrimpfishtendersilkyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the shrimp and fish pieces dry with paper towels — this helps them brown slightly instead of steaming when they hit the hot broth.

  2. Step 2

    In a small bowl, stir together the gochujang, water, and sesame oil until smooth — this is your dipping sauce.

  3. Step 3

    Pour the anchovy stock into a large pot or shallow hot-pot vessel and set it over medium-high heat until small bubbles form around the edges, about 3 minutes.

  4. Step 4

    Stir 3 tablespoons of soy sauce into the hot broth until fully blended.

  5. Step 5

    Arrange the shrimp and fish chunks on one side of the pot and the napa cabbage on the other side — they will cook in the simmering broth.

  6. Step 6

    Maintain the broth at a gentle simmer (small bubbles breaking the surface steadily) and let cook uncovered for 8 minutes, until the shrimp are pink and opaque and the fish is flaky when poked.

  7. Step 7

    Ladle the broth, seafood, and vegetables into two bowls, dividing evenly.

  8. Step 8

    Serve each bowl with a small ramekin of the gochujang dipping sauce on the side for each diner to add to taste.

Tools you’ll need

  • large pot or shallow hot-pot vessel (8-10 inches wide)
  • small bowl
  • wooden spoon or ladle
  • paper towels
  • two serving bowls
  • two small ramekins or dipping bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.