Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Harajuku Crepes with Matcha & Strawberry

Delicate Japanese-style crepes with sweet matcha cream and fresh strawberries—street food elegance at home. Takes 45 minutes start to finish.

Total time
45 min
Servings
4
Calories
385
Protein
7g
Harajuku Crepes with Matcha & Strawberry
elegantlightjapanesevegetariancrispycreamytenderweeknight

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour, milk, eggs, melted butter, and sugar until smooth. Let rest 15 minutes.

  2. Step 2

    Heat a non-stick skillet (8-inch) over medium-high until it shimmers, ~90 seconds.

  3. Step 3

    Pour 1/4 cup batter and tilt pan in a circular motion until bottom is covered in a thin layer.

  4. Step 4

    Cook until the bottom is light golden, ~60 seconds, then flip and cook the other side 30 seconds.

  5. Step 5

    Transfer to a plate. Repeat with remaining batter, stacking crepes as you go.

  6. Step 6

    Whisk matcha powder into condensed milk until no lumps remain and color is uniform green.

  7. Step 7

    Fold matcha mixture into whipped cream until combined; do not overmix.

  8. Step 8

    Hull and slice strawberries into thin strips.

  9. Step 9

    Place one crepe flat. Spread 2 tbsp matcha cream on one half, arrange strawberries on top.

  10. Step 10

    Fold crepe in half, then in half again to form a triangle. Drizzle with any remaining cream.

  11. Step 11

    Serve immediately. Repeat with remaining crepes.

Tools you’ll need

  • 8-inch non-stick skillet
  • medium mixing bowl
  • whisk
  • spatula
  • small bowl
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.