Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Harissa Meatballs with Whipped Feta & Rice

Spiced beef meatballs baked with harissa, served over fluffy white rice and topped with creamy whipped feta. A 25-minute Mediterranean dinner that tastes way more impressive than it actually is.

Total time
25 min
Servings
2
Calories
520
Protein
26g
Harissa Meatballs with Whipped Feta & Rice
satisfyingsimplemediterraneanbeeftendercreamyweeknightmain-dish

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Start rice in a pot with 2 cups salted water; bring to a boil, then reduce heat and cover.

  2. Step 2

    Mix ground beef with 2 tbsp harissa and a pinch of salt, then roll into 8–10 balls.

  3. Step 3

    Place meatballs on a sheet pan and bake at 400°F until cooked through, about 12 minutes.

  4. Step 4

    While meatballs cool slightly, mash feta with 1 tbsp harissa and 2 tbsp water until creamy.

  5. Step 5

    Divide rice between bowls, top with meatballs, and dollop whipped feta on the side.

Tools you’ll need

  • 1 pot with lid
  • 1 sheet pan
  • 1 small bowl
  • 1 spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.