Custrd is out on the App Store — Download it free →
Back to recipes

Herb-Crusted Fish with Green Sauce and Vegetables

A quick, elegant weeknight dinner: white fish fillets with a crispy herb crust, served over fresh cucumber ribbons and a vibrant green herb sauce.

Total time
20 min
Servings
4
Calories
320
Protein
30g
Herb-Crusted Fish with Green Sauce and Vegetables
quickelegantAmericangluten-freefishcrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 4 fish fillets dry and season both sides with salt and pepper. In a shallow dish, mix the 1/2 cup panko with 1 tablespoon of the olive oil and a handful of chopped parsley (about 2 tablespoons).

  2. Step 2

    Press each fillet into the crumb mixture to coat the top side. Heat 1 tablespoon olive oil in a large nonstick skillet over medium-high heat. Place fillets crust-side down and cook until golden and crisp, about 3 minutes.

  3. Step 3

    Flip the fillets and cook until the fish is opaque and flakes easily, about 3-4 more minutes. Remove from the skillet and set aside.

  4. Step 4

    While the fish cooks, use a vegetable peeler to slice the cucumber into long ribbons. In a bowl, toss the ribbons with the remaining 1 tablespoon olive oil, the juice of the lemon, and a pinch of salt.

  5. Step 5

    To make the green sauce, blend the remaining parsley (about 3/4 cup) with 2 tablespoons olive oil, 1 tablespoon lemon juice, and a pinch of salt until smooth. Serve the fish over the cucumber ribbons, drizzled with the green sauce and topped with black pepper.

Tools you’ll need

  • Large nonstick skillet
  • Vegetable peeler
  • Blender or food processor
  • Shallow dish
  • Mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.