CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Crispy Cheese & Spinach Pie

Phyllo layers stuffed with feta, spinach, and herbs, brushed with butter and baked until golden. A fast, crunchy take on tiropita that tastes like Greece in 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
12g
20-Min Crispy Cheese & Spinach Pie
comfortelegantgreekvegetariancheesecrispyflakycreamy

Ingredients

  • 10 oz frozen spinach, thawed and squeezed dry
  • 8 oz feta cheese, crumbled
  • 8 sheets phyllo dough, thawed
  • 4 tbsp butter, melted
  • 2 tbsp fresh dill (or parsley), chopped
  • ½ tsp lemon zest
  • 1 whole egg, beaten

Instructions

  1. 1

    Preheat oven to 400°F. Mix spinach, feta, dill, lemon zest, and beaten egg in a bowl.

  2. 2

    Lay one phyllo sheet on a work surface, brush lightly with melted butter, and repeat with 3 more sheets, stacking them.

  3. 3

    Spread half the spinach mixture along one long edge, roll tightly into a log, and coil it onto a parchment-lined baking sheet.

  4. 4

    Repeat with remaining 4 phyllo sheets and spinach mixture to make a second coil.

  5. 5

    Brush both coils with remaining melted butter. Bake for 12–14 minutes until golden brown and crispy.

  6. 6

    Cool 2 minutes, cut into wedges, and serve warm.

Tools you’ll need

  • 9x13-inch baking sheet
  • parchment paper
  • small mixing bowl
  • pastry brush
  • oven
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.