Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Cheese & Spinach Pie

Phyllo layers stuffed with feta, spinach, and herbs, brushed with butter and baked until golden. A fast, crunchy take on tiropita that tastes like Greece in 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
12g
20-Min Crispy Cheese & Spinach Pie
comfortelegantgreekvegetariancheesecrispyflakycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Mix spinach, feta, dill, lemon zest, and beaten egg in a bowl.

  2. Step 2

    Lay one phyllo sheet on a work surface, brush lightly with melted butter, and repeat with 3 more sheets, stacking them.

  3. Step 3

    Spread half the spinach mixture along one long edge, roll tightly into a log, and coil it onto a parchment-lined baking sheet.

  4. Step 4

    Repeat with remaining 4 phyllo sheets and spinach mixture to make a second coil.

  5. Step 5

    Brush both coils with remaining melted butter. Bake for 12–14 minutes until golden brown and crispy.

  6. Step 6

    Cool 2 minutes, cut into wedges, and serve warm.

Tools you’ll need

  • 9x13-inch baking sheet
  • parchment paper
  • small mixing bowl
  • pastry brush
  • oven
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.