Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Kajang Satay with Peanut Glaze

Mixed skewered protein glazed with a sweet-savory peanut sauce inspired by Kajang's signature style. Ready in 25 minutes with a broiler and one bowl.

Total time
25 min
Servings
4
Calories
420
Protein
38g
Kajang Satay with Peanut Glaze
casualsatisfyingmalaysianchickenshrimptendercrispyjuicy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Thread chicken and shrimp alternately onto metal skewers, dividing evenly.

  2. Step 2

    Whisk peanut butter, coconut milk, soy sauce, tamarind, sugar, and garlic until smooth.

  3. Step 3

    Brush satay generously with half the peanut sauce, coating all sides.

  4. Step 4

    Broil 4 inches from heat for 8–10 minutes, turning halfway, until chicken is cooked through.

  5. Step 5

    Brush remaining sauce over hot skewers until glossy.

  6. Step 6

    Serve immediately with extra sauce for dipping.

Tools you’ll need

  • metal skewers (8–10 inches)
  • broiler pan or oven-safe sheet pan
  • small whisk
  • brush for basting

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.