Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Lebanese Mushroom Hummus

Creamy hummus topped with sautéed mushrooms, garlic, and warm spiced oil. A Lebanese-inspired dip that works as an appetizer, mezze, or side.

Total time
15 min
Servings
6
Calories
215
Protein
8g
Lebanese Mushroom Hummus
freshsimplelebanesevegetarianveganchickpeascreamytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Add chickpeas, tahini, lemon juice, 2 minced garlic cloves, 2 tbsp olive oil, and 2 tbsp cold water to a food processor.

  2. Step 2

    Pulse until smooth and creamy. Season with salt and pepper to taste.

  3. Step 3

    Transfer hummus to a shallow bowl and spread into an even layer.

  4. Step 4

    Heat 2 tbsp olive oil in a large skillet over medium-high heat until shimmering, ~90 seconds.

  5. Step 5

    Add sliced mushrooms. Cook without stirring for 3 minutes until edges curl and brown.

  6. Step 6

    Stir in remaining garlic clove and cook until fragrant, ~30 seconds.

  7. Step 7

    Season with salt and pepper. Spoon warm mushroom mixture over hummus and serve immediately.

Tools you’ll need

  • food processor
  • large skillet
  • shallow serving bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.