Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Malaysian Mee Goreng with Chicken & Shrimp Crackers

Tangy, spicy fried noodles with stir-fried chicken, served alongside crispy shrimp crackers and cool cucumber slices. Comes together in under 25 minutes on one pan.

Total time
25 min
Servings
2
Calories
620
Protein
28g
Malaysian Mee Goreng with Chicken & Shrimp Crackers
boldsatisfyingmalaysianchickencrispytenderchewyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil the egg noodles in salted water until just tender, about 3 minutes. Drain and set aside.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over high heat until shimmering, about 90 seconds.

  3. Step 3

    Add chicken pieces and stir-fry until no pink remains and edges are golden, 6–7 minutes.

  4. Step 4

    Stir in chili paste, then add cooked noodles, soy sauce, and ketchup. Toss constantly until noodles are glossy and well coated, 2 minutes.

  5. Step 5

    Squeeze lime juice over the top and taste; adjust chili paste or soy sauce as needed for balance.

  6. Step 6

    Serve hot alongside fresh cucumber slices and shrimp crackers on the side.

Tools you’ll need

  • large skillet (12-inch or equivalent)
  • large pot for boiling noodles
  • wooden spoon or spatula
  • tongs or chopsticks

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.