Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Mamak-Style Mee Goreng With Crispy Chicken

Spicy, tangy stir-fried noodles with crispy chicken, shrimp crackers, and fresh cucumber—a 25-minute weeknight take on the Malaysian hawker classic. Sweet, sour, hot, and perfectly sticky.

Total time
25 min
Servings
2
Calories
520
Protein
28g
Mamak-Style Mee Goreng With Crispy Chicken
comfortboldmalaysianchickenshrimpcrispychewyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil egg noodles in salted water until al dente, about 3 minutes. Drain and set aside.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over medium-high heat until it shimmers, about 90 seconds.

  3. Step 3

    Add chicken and cook, stirring occasionally, until edges are golden and cooked through, 6–7 minutes.

  4. Step 4

    Stir in chili paste and cook for 30 seconds until fragrant, then add cooked noodles, soy sauce, lime juice, and ketchup.

  5. Step 5

    Toss everything together over medium heat for 2 minutes until noodles are glossy and coated.

  6. Step 6

    Divide between bowls, top with shrimp crackers and cucumber slices. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • pot (2-quart)
  • tongs or wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.